Recombinant Saccharomyces cerevisiae Chitin deacetylase 2 (CDA2)

Artikelnummer: CSB-YP027962SVG
Artikelname: Recombinant Saccharomyces cerevisiae Chitin deacetylase 2 (CDA2)
Artikelnummer: CSB-YP027962SVG
Hersteller Artikelnummer: CSB-YP027962SVG
Alternativnummer: CSB-YP027962SVG-1, CSB-YP027962SVG-100, CSB-YP027962SVG-20
Hersteller: Cusabio
Kategorie: Proteine/Peptide
Alternative Synonym: CDA2, YLR308W, L2142.1Chitin deacetylase 2, EC 3.5.1.41
Molekulargewicht: 34.9 kDa
Tag: N-terminal 6xHis-tagged
UniProt: Q06703
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Yeast
Expression System: 26-312aa
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: EANREDLKQIDFQFPVLERAATKTPFPDWLSAFTGLKEWPGLDPPYIPLDFIDFSQIPDYKEYDQNHCDSVPRDSCSFDCHHCTEHDDVYTCSKLSQTFDDGPSASTTKLLDRLKHNSTFFNLGVNIVQHPDIYQRMQKEGHLIGSHTWSHVYLPNVSNEKIIAQIEWSIWAMNATGNHTPKWFRPPYGGIDNRVRAITRQFGLQAVLWDHDTFDWSLLLNDSVITEQEILQNVINWNKSGTGLILEHDSTEKT