Recombinant Macaca mulatta Oncostatin M (OSM), partial

Produktübersicht

• Artikelname: Recombinant Macaca mulatta Oncostatin M (OSM), partial
• Artikelnummer: CSB-YP2949MOWF3
• Hersteller Artikelnummer: CSB-YP2949MOWf3
• Alternativnummer: CSB-YP2949MOWF3-1, CSB-YP2949MOWF3-100, CSB-YP2949MOWF3-20
• Hersteller: Cusabio
• Kategorie: Proteine/Peptide
• Alternative Synonym: /

Produkteigenschaften

• Molekulargewicht: 27.1 kDa
• Tag: C-terminal 6xHis-Myc-tagged
• UniProt: F7GF43
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Yeast
• Expression System: 22-252aa
• Reinheit: Greater than 90% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: MASMAAMGSCSKEYRMLLGQLQKQTDLMQDTSRLLDPYIRIQGLDIPKLREHCRESPGAFPSEETLRGLGRRGFLQTLNATLGRVLHRLADLEQHLPKAQDLERSGLNIEDLEKLQMARPNVLGLRNNVYCMAQLLDNSDMTEPTKAGRGTPQPPTPTPTSDVFQRKLEGCSFLRGYHRFMHSVGRVFSKWGESPNRSRRHSPHQALRKGVRRTRPSRKGNRLMPRGQLPR