Recombinant Enterobacteria phage H19B Shiga-like toxin 1 subunit B (stxB)

Produktübersicht

• Artikelname: Recombinant Enterobacteria phage H19B Shiga-like toxin 1 subunit B (stxB)
• Artikelnummer: CSB-YP300809EKZ
• Hersteller Artikelnummer: CSB-YP300809EKZ
• Alternativnummer: CSB-YP300809EKZ-1, CSB-YP300809EKZ-100, CSB-YP300809EKZ-20
• Hersteller: Cusabio
• Kategorie: Proteine/Peptide
• Alternative Synonym: Verocytotoxin 1 subunit B ,Verotoxin 1 subunit B,CSB-PR2024

Produkteigenschaften

• Molekulargewicht: 9.7 kDa
• Tag: N-terminal 6xHis-tagged
• UniProt: P69179
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Yeast
• Expression System: 21-89aa
• Reinheit: Greater than 90% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: TPDCVTGKVEYTKYNDDDTFTVKVGDKELFTNRWNLQSLLLSAQITGMTVTIKTNACHNGGGFSEVIFR