Recombinant Enterobacteria phage M13 Attachment protein G3P (III)

Produktübersicht

• Artikelname: Recombinant Enterobacteria phage M13 Attachment protein G3P (III)
• Artikelnummer: CSB-YP303116ECY
• Hersteller Artikelnummer: CSB-YP303116ECY
• Alternativnummer: CSB-YP303116ECY-1, CSB-YP303116ECY-100, CSB-YP303116ECY-20
• Hersteller: Cusabio
• Kategorie: Proteine/Peptide
• Alternative Synonym: Gene 3 protein Short name: G3P Minor coat protein

Produkteigenschaften

• Molekulargewicht: 44.6 kDa
• Tag: N-terminal 6xHis-tagged
• UniProt: P69168
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Yeast
• Expression System: 19-424aa
• Reinheit: Greater than 90% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: AETVESCLAKPHTENSFTNVWKDDKTLDRYANYEGCLWNATGVVVCTGDETQCYGTWVPIGLAIPENEGGGSEGGGSEGGGSEGGGTKPPEYGDTPIPGYTYINPLDGTYPPGTEQNPANPNPSLEESQPLNTFMFQNNRFRNRQGALTVYTGTVTQGTDPVKTYYQYTPVSSKAMYDAYWNGKFRDCAFHSGFNEDPFVCEYQGQSSDLPQPPVNAGGGSGGGSGGGSEGGGSEGGGSEGGGSEGGGSGGGSG