Recombinant Hypocrea jecorina Hydrophobin-2 (hfb2)
Artikelnummer:
CSB-YP304437HYE
- Bilder (0)
| Artikelname: | Recombinant Hypocrea jecorina Hydrophobin-2 (hfb2) |
| Artikelnummer: | CSB-YP304437HYE |
| Hersteller Artikelnummer: | CSB-YP304437HYE |
| Alternativnummer: | CSB-YP304437HYE-1, CSB-YP304437HYE-100, CSB-YP304437HYE-20 |
| Hersteller: | Cusabio |
| Kategorie: | Proteine/Peptide |
| Alternative Synonym: | Hydrophobin II |
| Molekulargewicht: | 9.2 kDa |
| Tag: | N-terminal 6xHis-tagged |
| UniProt: | P79073 |
| Puffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Quelle: | Yeast |
| Expression System: | 16-86aa |
| Reinheit: | Greater than 85% as determined by SDS-PAGE. |
| Formulierung: | Liquid or Lyophilized powder |
| Sequenz: | AVCPTGLFSNPLCCATNVLDLIGVDCKTPTIAVDTGAIFQAHCASKGSKPLCCVAPVADQALLCQKAIGTF |
Produktgarantie und fachkundiger Support
