Recombinant Trichoderma reesei Hydrophobin-2 (hfb2)

Produktübersicht

• Artikelname: Recombinant Trichoderma reesei Hydrophobin-2 (hfb2)
• Artikelnummer: CSB-YP304437HYEA4
• Hersteller Artikelnummer: CSB-YP304437HYEa4
• Alternativnummer: CSB-YP304437HYEA4-1, CSB-YP304437HYEA4-100, CSB-YP304437HYEA4-20
• Hersteller: Cusabio
• Kategorie: Proteine/Peptide
• Alternative Synonym: Hydrophobin II,CSB-PR2024

Produkteigenschaften

• Molekulargewicht: 23.2 kDa
• Tag: N-terminal 6xHis-sumostar-tagged
• UniProt: P79073
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Yeast
• Expression System: 16-86aa
• Reinheit: Greater than 90% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: AVCPTGLFSNPLCCATNVLDLIGVDCKTPTIAVDTGAIFQAHCASKGSKPLCCVAPVADQALLCQKAIGTF