Recombinant Juniperus ashei Pectate lyase 1

Produktübersicht

• Artikelname: Recombinant Juniperus ashei Pectate lyase 1
• Artikelnummer: CSB-YP305864JAN
• Hersteller Artikelnummer: CSB-YP305864JAN
• Alternativnummer: CSB-YP305864JAN-1, CSB-YP305864JAN-100, CSB-YP305864JAN-20
• Hersteller: Cusabio
• Kategorie: Proteine/Peptide
• Alternative Synonym: , Pectate lyase 1, EC 4.2.2.2, Major pollen allergen Jun a 1, allergen Jun a 1,CSB-PR2024

Produkteigenschaften

• Molekulargewicht: 39.6 kDa
• Tag: N-terminal 6xHis-tagged
• UniProt: P81294
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Yeast
• Expression System: 22-367aa
• Reinheit: Greater than 90% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: DNPIDSCWRGDSNWDQNRMKLADCAVGFGSSTMGGKGGDFYTVTSTDDNPVNPTPGTLRYGATREKALWIIFSQNMNIKLKMPLYVAGHKTIDGRGADVHLGNGGPCLFMRKVSHVILHSLHIHGCNTSVLGDVLVSESIGVEPVHAQDGDAITMRNVTNAWIDHNSLSDCSDGLIDVTLGSTGITISNNHFFNHHKVMLLGHDDTYDDDKSMKVTVAFNQFGPNAGQRMPRARYGLVHVANNNYDPWNIYAIG