Recombinant Arabidopsis thaliana Putative defensin-like protein 70 (LCR83)

Produktübersicht

• Artikelname: Recombinant Arabidopsis thaliana Putative defensin-like protein 70 (LCR83)
• Artikelnummer: CSB-YP306814DOA
• Hersteller Artikelnummer: CSB-YP306814DOA
• Alternativnummer: CSB-YP306814DOA-1, CSB-YP306814DOA-100, CSB-YP306814DOA-20
• Hersteller: Cusabio
• Kategorie: Proteine/Peptide
• Alternative Synonym: Putative low-molecular-weight cysteine-rich protein 83 Short name: Protein LCR83

Produkteigenschaften

• Molekulargewicht: 32.9 kDa
• Tag: N-terminal GST-tagged
• UniProt: P82792
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Yeast
• Expression System: 28-82aa
• Reinheit: Greater than 90% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: NFASGEASSQLCFNPCTPQLGNNECNTICMNKKYKEGSCVGFGIPPTSKYCCCKT