Recombinant Silene chalcedonica Ribosome-inactivating protein lychnin

Artikelnummer: CSB-YP307648LKN
Artikelname: Recombinant Silene chalcedonica Ribosome-inactivating protein lychnin
Artikelnummer: CSB-YP307648LKN
Hersteller Artikelnummer: CSB-YP307648LKN
Alternativnummer: CSB-YP307648LKN-1, CSB-YP307648LKN-100, CSB-YP307648LKN-20
Hersteller: Cusabio
Kategorie: Proteine/Peptide
Alternative Synonym: Ribosome-inactivating protein lychnin, EC 3.2.2.22
Molekulargewicht: 28.1 kDa
Tag: N-terminal 6xHis-tagged
UniProt: P85101
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Yeast
Expression System: 1-234aa
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: RPSWTVDSDSAKYSSFLDSLREEFGRGTPKVCNIPVTKKANNDKFVLVNLVLPFNRNTITLAFRASDAYLVGFQDRDSKTNKLRANFFSDEYRALSGKYKSIFTDAEVLAPALPCASTYTDLQNKAGVSREKLSLGVSSLQTAFTAVYGKVFTGKNVAKFALISIQMVAEAARFKYIEDQVINRGMYSSFEAGARITLLENNWSKISEQYHKSCKLGGGQFTEEEMKLGLLLYN