Recombinant Dactylis glomerata Major pollen allergen Dac g 4, partial

Produktübersicht

• Artikelname: Recombinant Dactylis glomerata Major pollen allergen Dac g 4, partial
• Artikelnummer: CSB-YP307868DAC
• Hersteller Artikelnummer: CSB-YP307868DAC
• Alternativnummer: CSB-YP307868DAC-1, CSB-YP307868DAC-100, CSB-YP307868DAC-20
• Hersteller: Cusabio
• Kategorie: Proteine/Peptide
• Alternative Synonym: Allergen: Dac g 4,CSB-PR2024

Produkteigenschaften

• Molekulargewicht: 8.4 kDa
• Tag: N-terminal 6xHis-tagged
• UniProt: P82946
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Yeast
• Expression System: 1-55aa
• Reinheit: Greater than 90% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: DIYNYMEPYVSKVDPTDYFGNEQARTAWVDSGAQLGELSYGVLFNIQYVNYWFAP