Recombinant Helicobacter pylori Glutamate--tRNA ligase 1 (gltX1)

Produktübersicht

• Artikelname: Recombinant Helicobacter pylori Glutamate--tRNA ligase 1 (gltX1)
• Artikelnummer: CSB-YP308728HUV
• Hersteller Artikelnummer: CSB-YP308728HUV
• Alternativnummer: CSB-YP308728HUV-1, CSB-YP308728HUV-100, CSB-YP308728HUV-20
• Hersteller: Cusabio
• Kategorie: Proteine/Peptide
• Alternative Synonym: Glutamyl-tRNA synthetase 1

Produkteigenschaften

• Molekulargewicht: 55.4 kDa
• Tag: N-terminal 6xHis-tagged
• UniProt: P96551
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Yeast
• Expression System: 1-463aa
• Reinheit: Greater than 90% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: MSLIVTRFAPSPTGYLHIGGLRTAIFNYLFARANQGKFFLRIEDTDLSRNSIEAANAIIEAFKWVGLEYDGEILYQSKRFEIYKEYIQKLLDEDKAYYCYMSKEELDALREEQKARKETPRYDNRYRDFKGTPPKGIEPVVRIKVPQNEVIGFNDGVKGEVKVNTNELDDFIIARSDGTPTYNFVVTIDDALMGITDVIRGDDHLSNTPKQIVLYKALNFKIPNFFHVPMILNEEGQKLSKRHGATNVMDYQEM