Recombinant Avian infectious bronchitis virus Non-structural protein 5a (5a)
Artikelnummer:
CSB-YP803640ARN
- Bilder (0)
| Artikelname: | Recombinant Avian infectious bronchitis virus Non-structural protein 5a (5a) |
| Artikelnummer: | CSB-YP803640ARN |
| Hersteller Artikelnummer: | CSB-YP803640ARN |
| Alternativnummer: | CSB-YP803640ARN-1, CSB-YP803640ARN-100, CSB-YP803640ARN-20 |
| Hersteller: | Cusabio |
| Kategorie: | Proteine/Peptide |
| Alternative Synonym: | (ns5a)(Accessory protein 5a) |
| Molekulargewicht: | 20.3 kDa |
| Tag: | C-terminal 6xHis-sumostar-tagged |
| UniProt: | Q89613 |
| Puffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Quelle: | Yeast |
| Expression System: | 1-65aa |
| Reinheit: | Greater than 90% as determined by SDS-PAGE. |
| Formulierung: | Liquid or Lyophilized powder |
| Sequenz: | MKWLTSFGRAVISCYKSLLLTQLRVLDRLILDHGLLRVLTCSRRVLLVQLDLVYRLAYTPTQSLA |
Produktgarantie und fachkundiger Support
