Recombinant Mouse Dedicator of cytokinesis protein 8 (Dock8), partial
Artikelnummer:
CSB-YP807451MO1
- Bilder (0)
| Artikelname: | Recombinant Mouse Dedicator of cytokinesis protein 8 (Dock8), partial |
| Artikelnummer: | CSB-YP807451MO1 |
| Hersteller Artikelnummer: | CSB-YP807451MO1 |
| Alternativnummer: | CSB-YP807451MO1-1, CSB-YP807451MO1-100, CSB-YP807451MO1-20 |
| Hersteller: | Cusabio |
| Kategorie: | Proteine/Peptide |
| Alternative Synonym: | Dock8Dedicator of cytokinesis protein 8,CSB-PR2024 |
| Molekulargewicht: | 21.2 kDa |
| Tag: | N-terminal 6xHis-tagged |
| UniProt: | Q8C147 |
| Puffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Quelle: | Yeast |
| Expression System: | 561-730aa |
| Reinheit: | Greater than 85% as determined by SDS-PAGE. |
| Formulierung: | Liquid or Lyophilized powder |
| Sequenz: | RNLLYVYPQRLNFASKLASARNITIKIQFMCGEDPSNAMPVIFGKSSGPEFLQEVYTAITYHNKSPDFYEEVKIKLPAKLTVNHHLLFTFYHISCQQKQGASGESLLGYSWLPILLNERLQTGSYCLPVALEKLPPNYSIHSAEKVPLQNPPIKWAEGHKGVFNIEVQAV |
Produktgarantie und fachkundiger Support
