Recombinant Human m7GpppN-mRNA hydrolase (DCP2)

Produktübersicht

• Artikelname: Recombinant Human m7GpppN-mRNA hydrolase (DCP2)
• Artikelnummer: CSB-YP810265HU
• Hersteller Artikelnummer: CSB-YP810265HU
• Alternativnummer: CSB-YP810265HU-1, CSB-YP810265HU-100, CSB-YP810265HU-20
• Hersteller: Cusabio
• Kategorie: Proteine/Peptide
• Alternative Synonym: Nucleoside diphosphate-linked moiety X motif 20 ,Nudix motif 20mRNA-decapping enzyme 2 ,hDpc

Produkteigenschaften

• Molekulargewicht: 46.4 kDa
• Tag: N-terminal 6xHis-tagged
• UniProt: Q8IU60
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Yeast
• Expression System: 1-385aa
• Reinheit: Greater than 90% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: METKRVEIPGSVLDDLCSRFILHIPSEERDNAIRVCFQIELAHWFYLDFYMQNTPGLPQCGIRDFAKAVFSHCPFLLPQGEDVEKVLDEWKEYKMGVPTYGAIILDETLENVLLVQGYLAKSGWGFPKGKVNKEEAPHDCAAREVFEETGFDIKDYICKDDYIELRINDQLARLYIIPGIPKDTKFNPKTRREIRNIEWFSIEKLPCHRNDMTPKSKLGLAPNKFFMAIPFIRPLRDWLSRRFGDSSDSDNGFS