Recombinant Human Pulmonary surfactant-associated protein A1 (SFTPA1)
Artikelnummer:
CSB-YP810281HU
- Bilder (0)
| Artikelname: | Recombinant Human Pulmonary surfactant-associated protein A1 (SFTPA1) |
| Artikelnummer: | CSB-YP810281HU |
| Hersteller Artikelnummer: | CSB-YP810281HU |
| Alternativnummer: | CSB-YP810281HU-1, CSB-YP810281HU-100, CSB-YP810281HU-20 |
| Hersteller: | Cusabio |
| Kategorie: | Proteine/Peptide |
| Alternative Synonym: | 35 kDa pulmonary surfactant-associated protein Alveolar proteinosis protein Collectin-4 COLEC4, PSAP, SFTP1, SFTPA, SFTPA1B |
| Molekulargewicht: | 26.2 kDa |
| Tag: | N-terminal 6xHis-tagged |
| UniProt: | Q8IWL2 |
| Puffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Quelle: | Yeast |
| Expression System: | 21-248aa |
| Reinheit: | Greater than 85% as determined by SDS-PAGE. |
| Formulierung: | Liquid or Lyophilized powder |
| Sequenz: | EVKDVCVGSPGIPGTPGSHGLPGRDGRDGLKGDPGPPGPMGPPGEMPCPPGNDGLPGAPGIPGECGEKGEPGERGPPGLPAHLDEELQATLHDFRHQILQTRGALSLQGSIMTVGEKVFSSNGQSITFDAIQEACARAGGRIAVPRNPEENEAIASFVKKYNTYAYVGLTEGPSPGDFRYSDGTPVNYTNWYRGEPAGRGKEQCVEMYTDGQWNDRNCLYSRLTICEF |
Produktgarantie und fachkundiger Support
