Recombinant Mouse Alpha/beta hydrolase domain-containing protein 11 (Abhd11)
Artikelnummer:
CSB-YP811717MO
- Bilder (0)
| Artikelname: | Recombinant Mouse Alpha/beta hydrolase domain-containing protein 11 (Abhd11) |
| Artikelnummer: | CSB-YP811717MO |
| Hersteller Artikelnummer: | CSB-YP811717MO |
| Alternativnummer: | CSB-YP811717MO-1, CSB-YP811717MO-100, CSB-YP811717MO-20 |
| Hersteller: | Cusabio |
| Kategorie: | Proteine/Peptide |
| Alternative Synonym: | Williams-Beuren syndrome chromosomal region 21 protein homolog |
| Molekulargewicht: | 35.6 kDa |
| Tag: | N-terminal 6xHis-tagged |
| UniProt: | Q8K4F5 |
| Puffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Quelle: | Yeast |
| Expression System: | 1-307aa |
| Reinheit: | Greater than 90% as determined by SDS-PAGE. |
| Formulierung: | Liquid or Lyophilized powder |
| Sequenz: | MLRWARAWRVPRGVLGASSPRRLAVPVTFCSSRSSGQENADLRPLPLSYNLLDGDATLPAIVFLHGLFGSKTNFNSLAKAMVQRTGRRVLTVDARNHGDSPHSPDASYEAMSQDLQGLLPQLGLVPCVLVGHSMGGKTAMLLALQRPDVVERLVVVDISPVGTTPGSHIGAFIAAMKAVEIPEKVPHSQARKLADKQLSSVVKEAGIRQFLLTNLVEVGGRFSWRLNLDTLAQHLDKIMTFPQQREPYSGPTLF |
Produktgarantie und fachkundiger Support
