Recombinant Mouse Protein delta homolog 2 (Dlk2), partial

Produktübersicht

• Artikelname: Recombinant Mouse Protein delta homolog 2 (Dlk2), partial
• Artikelnummer: CSB-YP812967MO
• Hersteller Artikelnummer: CSB-YP812967MO
• Alternativnummer: CSB-YP812967MO-1, CSB-YP812967MO-100, CSB-YP812967MO-20
• Hersteller: Cusabio
• Kategorie: Proteine/Peptide
• Alternative Synonym: Endothelial cell-specific protein S-1 Epidermal growth factor-like protein 9 Short name: EGF-like protein 9

Produkteigenschaften

• Molekulargewicht: 31.6 kDa
• Tag: N-terminal 6xHis-tagged
• UniProt: Q8K1E3
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Yeast
• Expression System: 27-305aa
• Reinheit: Greater than 90% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: DDCSSHCDLAHGCCAPDGSCRCDPGWEGLHCERCVRMPGCQHGTCHQPWQCICHSGWAGKFCDKDEHICTSQSPCQNGGQCVYDGGGEYHCVCLPGFHGRGCERKAGPCEQAGFPCRNGGQCQDNQGFALNFTCRCLAGFMGAHCEVNVDDCLMRPCANGATCIDGINRFSCLCPEGFAGRFCTINLDDCASRPCQRGARCRDRVHDFDCLCPSGYGGKTCELVLPAPEPASVGTPQMPTSAVVVPATGPAPHS