Recombinant Mouse Galectin-4 (Lgals4)

Artikelnummer: CSB-YP812998MO
Artikelname: Recombinant Mouse Galectin-4 (Lgals4)
Artikelnummer: CSB-YP812998MO
Hersteller Artikelnummer: CSB-YP812998MO
Alternativnummer: CSB-YP812998MO-1, CSB-YP812998MO-100, CSB-YP812998MO-20
Hersteller: Cusabio
Kategorie: Proteine/Peptide
Alternative Synonym: Gal-4 Alternative name(s): Lactose-binding lectin 4
Molekulargewicht: 38.4 kDa
Tag: N-terminal 6xHis-tagged
UniProt: Q8K419
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Yeast
Expression System: 1-326aa
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: MAYVPAPGYQPTYNPTLPYKRPIPGGLSVGMSVYIQGMAKENMRRFHVNFAVGQDDGADVAFHFNPRFDGWDKVVFNTMQSGQWGKEEKKKSMPFQKGKHFELVFMVMPEHYKVVVNGNSFYEYGHRLPVQMVTHLQVDGDLELQSINFLGGQPAAAPYPGAMTIPAYPAGSPGYNPPQMNTLPVMTGPPVFNPRVPYVGALQGGLTVRRTIIIKGYVLPTARNFVINFKVGSSGDIALHLNPRIGDSVVRNSF