Recombinant Vibrio vulnificus Fe/S biogenesis protein NfuA (nfuA)

Produktübersicht

• Artikelname: Recombinant Vibrio vulnificus Fe/S biogenesis protein NfuA (nfuA)
• Artikelnummer: CSB-YP813457VFI
• Hersteller Artikelnummer: CSB-YP813457VFI
• Alternativnummer: CSB-YP813457VFI-1, CSB-YP813457VFI-100, CSB-YP813457VFI-20
• Hersteller: Cusabio
• Kategorie: Proteine/Peptide
• Alternative Synonym: nfuA, VV1_0864, Fe/S biogenesis protein NfuA

Produkteigenschaften

• Molekulargewicht: 23 kDa
• Tag: N-terminal 6xHis-tagged
• UniProt: Q8DDU2
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Yeast
• Expression System: 1-194aa
• Reinheit: Greater than 90% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: MSNITITEAAQTHFANLLGQQPDGTNIRVFVVNPGTQNAECGVSYCPPEAVEATDTEIPYQSFSAYVDELSLPFLEDAEIDYVTDKMGSQLTLKAPNAKMRKVADDAPLLERVEYAIQTQVNPQLAGHGGHVKLMEITDAGVAIVAFGGGCNGCSMVDVTLKEGIEKELLQQFSGELTAVRDATEHDRGDHSYY