Recombinant Salmonella typhi Universal stress protein A (uspA)

Produktübersicht

• Artikelname: Recombinant Salmonella typhi Universal stress protein A (uspA)
• Artikelnummer: CSB-YP820596SWW
• Hersteller Artikelnummer: CSB-YP820596SWW
• Alternativnummer: CSB-YP820596SWW-1, CSB-YP820596SWW-100, CSB-YP820596SWW-20
• Hersteller: Cusabio
• Kategorie: Proteine/Peptide
• Alternative Synonym: uspA, STY4212, t3925, Universal stress protein A

Produkteigenschaften

• Molekulargewicht: 17.9 kDa
• Tag: N-terminal 6xHis-tagged
• UniProt: Q8Z268
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Yeast
• Expression System: 2-144aa
• Reinheit: Greater than 90% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: AYKHILIAVDLSPESKVLVEKAVSMARPYNAKISLIHVDVNYSDLYTGLIDVNLGDMQKRISKETHHALTELSTNAGYPITETLSGSGDLGQVLVDAIKKYDMDLVVCGHHQDFWSKLMSSARQLINTVHVDMLIVPLRDEEE