Recombinant Bovine coronavirus Spike glycoprotein (S), partial

Produktübersicht

• Artikelname: Recombinant Bovine coronavirus Spike glycoprotein (S), partial
• Artikelnummer: CSB-YP820951BJE
• Hersteller Artikelnummer: CSB-YP820951BJE
• Alternativnummer: CSB-YP820951BJE-1, CSB-YP820951BJE-100, CSB-YP820951BJE-20
• Hersteller: Cusabio
• Kategorie: Proteine/Peptide
• Alternative Synonym: S glycoprotein,E2,Peplomer protein

Produkteigenschaften

• Molekulargewicht: 36.6 kDa
• Tag: C-terminal 6xHis-tagged
• UniProt: Q91A26
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Yeast
• Expression System: 314-634aa
• Reinheit: Greater than 90% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: TVQPIADVYRRIPNLPDCNIEAWLNDKSVPSPLNWERKTFSNCNFNMSSLMSFIQAYSFTCNNIDAAKIYGMCFSSITIDKFAIPNGRKVDLQLGNLGYLQSFNYRIDTTATSCQLYYNLPAANVSVSRFNPSTWNRRFGFTEQSVFKPQPAGVFTDHDVVYAQHCFKASTNFCPCKLDGSLCVGNGPGIDAGYKTSGIGTCPAGTNYLTCHNAAQCDCLCTPDPITSKATGPYKCPQTKYLVGIGEHCSGLAI