Recombinant Arabidopsis thaliana 2-Cys peroxiredoxin BAS1, chloroplastic (BAS1)

Artikelnummer: CSB-YP822134DOAB1
Artikelname: Recombinant Arabidopsis thaliana 2-Cys peroxiredoxin BAS1, chloroplastic (BAS1)
Artikelnummer: CSB-YP822134DOAB1
Hersteller Artikelnummer: CSB-YP822134DOAb1
Alternativnummer: CSB-YP822134DOAB1-1, CSB-YP822134DOAB1-100, CSB-YP822134DOAB1-20
Hersteller: Cusabio
Kategorie: Proteine/Peptide
Alternative Synonym: Thiol-specific antioxidant protein A
Molekulargewicht: 26.4 kDa
Tag: N-terminal 10xHis-tagged and C-terminal Myc-tagged
UniProt: Q96291
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Yeast
Expression System: 66-266aa
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: KAQADDLPLVGNKAPDFEAEAVFDQEFIKVKLSDYIGKKYVILFFYPLDFTFVCPTEITAFSDRHSEFEKLNTEVLGVSVDSVFSHLAWVQTDRKSGGLGDLNYPLISDVTKSISKSFGVLIHDQGIALRGLFIIDKEGVIQHSTINNLGIGRSVDETMRTLQALQYIQENPDEVCPAGWKPGEKSMKPDPKLSKEYFSAI