Recombinant Human 5 (3)-deoxyribonucleotidase, cytosolic type (NT5C)
Artikelnummer:
CSB-YP837431HU
- Bilder (0)
| Artikelname: | Recombinant Human 5 (3)-deoxyribonucleotidase, cytosolic type (NT5C) |
| Artikelnummer: | CSB-YP837431HU |
| Hersteller Artikelnummer: | CSB-YP837431HU |
| Alternativnummer: | CSB-YP837431HU-1, CSB-YP837431HU-100, CSB-YP837431HU-20 |
| Hersteller: | Cusabio |
| Kategorie: | Proteine/Peptide |
| Alternative Synonym: | (3)(Cytosolic 5,3-pyrimidine nucleotidase)(Deoxy-5-nucleotidase 1)(dNT-1) |
| Molekulargewicht: | 24.2 kDa |
| Tag: | C-terminal 6xHis-tagged |
| UniProt: | Q8TCD5 |
| Puffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Quelle: | Yeast |
| Expression System: | 1-201aa |
| Reinheit: | Greater than 90% as determined by SDS-PAGE. |
| Formulierung: | Liquid or Lyophilized powder |
| Sequenz: | MARSVRVLVDMDGVLADFEAGLLRGFRRRFPEEPHVPLEQRRGFLAREQYRALRPDLADKVASVYEAPGFFLDLEPIPGALDAVREMNDLPDTQVFICTSPLLKYHHCVGEKYRWVEQHLGPQFVERIILTRDKTVVLGDLLIDDKDTVRGQEETPSWEHILFTCCHNRHLVLPPTRRRLLSWSDNWREILDSKRGAAQRE |
Produktgarantie und fachkundiger Support
