Recombinant Bovine coronavirus Non-structural protein 2a (2a)

Produktübersicht

• Artikelname: Recombinant Bovine coronavirus Non-structural protein 2a (2a)
• Artikelnummer: CSB-YP838639BJE
• Hersteller Artikelnummer: CSB-YP838639BJE
• Alternativnummer: CSB-YP838639BJE-1, CSB-YP838639BJE-100, CSB-YP838639BJE-20
• Hersteller: Cusabio
• Kategorie: Proteine/Peptide
• Alternative Synonym: ns2a,32 kDa accessory protein,32 kDa non-structural protein,ns2,CSB-PR2024

Produkteigenschaften

• Molekulargewicht: 33.7 kDa
• Tag: C-terminal 6xHis-tagged
• UniProt: Q91A27
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Yeast
• Expression System: 1-278aa
• Reinheit: Greater than 85% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: MAVAYADKPNHFINFPLTQFQGFVLNYKGLQFQLLDEGVDCKIQTAPHISLAMLDIQPEDYRSVDVAIQEVIDDMHWGEGFQIKFENPHILGRCIVLDVKGVEELHDDLVNYIRDKGCVADQSRKWIGHCTIAQLTDAALSIKENVDFINNMQFNYKITINPSSPARLEIVKLGAERKDGFYETIASHWMGIRFEYNPPTDKLAMIMGYCCLEVVRKELEEGDLPENDDDAWFKLSYHYENNSWFFRHVYRKSS