Recombinant Mouse Secretoglobin family 3A member 2 (Scgb3a2)

Artikelnummer: CSB-YP846028MO
Artikelname: Recombinant Mouse Secretoglobin family 3A member 2 (Scgb3a2)
Artikelnummer: CSB-YP846028MO
Hersteller Artikelnummer: CSB-YP846028MO
Alternativnummer: CSB-YP846028MO-1, CSB-YP846028MO-100, CSB-YP846028MO-20
Hersteller: Cusabio
Kategorie: Proteine/Peptide
Alternative Synonym: Pneumo secretory protein 1 Short name: PnSP-1 Uteroglobin-related protein 1
Molekulargewicht: 15.2 kDa
Tag: N-terminal 6xHis-tagged
UniProt: Q920H1
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Yeast
Expression System: 22-139aa
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: LLINRLPVVDKLPVPLDDIIPSFDPLKMLLKTLGISVEHLVTGLKKCVDELGPEASEAVKKLLVIIICSYFPGRSLCYVNNLPSFVSVLFLPMICAYPRDSKKQTFAFIERVFEQSKL