Recombinant Mouse Lysyl oxidase homolog 4 (Loxl4)

Artikelnummer: CSB-YP846069MO
Artikelname: Recombinant Mouse Lysyl oxidase homolog 4 (Loxl4)
Artikelnummer: CSB-YP846069MO
Hersteller Artikelnummer: CSB-YP846069MO
Alternativnummer: CSB-YP846069MO-1, CSB-YP846069MO-100, CSB-YP846069MO-20
Hersteller: Cusabio
Kategorie: Proteine/Peptide
Alternative Synonym: Lysyl oxidase-like protein 4 Lysyl oxidase-related protein C
Molekulargewicht: 83.9 kDa
Tag: N-terminal 6xHis-tagged
UniProt: Q924C6
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Yeast
Expression System: 26-757aa
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: QSSGTKKLRLVGPTDRPEEGRLEVLHQGQWGTVCDDDFALQEATVACRQLGFESALTWAHSAKYGQGEGPIWLDNVRCLGTEKTLDQCGSNGWGVSDCRHSEDVGVVCHPRRQHGYHSEKVSNALGPQGRRLEEVRLKPILASAKRHSPVTEGAVEVRYDGHWRQVCDQGWTMNNSRVVCGMLGFPSQTSVNSHYYRKVWNLKMKDPKSRLNSLTKKNSFWIHRVDCLGTEPHLAKCQVQVAPGRGKLRPACPG