Recombinant Bovine coronavirus Non-structural protein of 4.8 kDa (4b)

Artikelnummer: CSB-YP848660BJN
Artikelname: Recombinant Bovine coronavirus Non-structural protein of 4.8 kDa (4b)
Artikelnummer: CSB-YP848660BJN
Hersteller Artikelnummer: CSB-YP848660BJN
Alternativnummer: CSB-YP848660BJN-1, CSB-YP848660BJN-100, CSB-YP848660BJN-20
Hersteller: Cusabio
Kategorie: Proteine/Peptide
Alternative Synonym: ns4.8,4.8 kDa accessory protein
Molekulargewicht: 6.4 kDa
Tag: C-terminal 6xHis-tagged
UniProt: Q8V6W4
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Yeast
Expression System: 1-45aa
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: MPMATTIDGTDYTNIMPSTVSTRVYLGCSIGIDTSTTGFTCFSWY