Recombinant Macaca fascicularis T-cell surface glycoprotein CD3 gamma chain (CD3G), partial

Produktübersicht

• Artikelname: Recombinant Macaca fascicularis T-cell surface glycoprotein CD3 gamma chain (CD3G), partial
• Artikelnummer: CSB-YP850179MOV
• Hersteller Artikelnummer: CSB-YP850179MOV
• Alternativnummer: CSB-YP850179MOV-1, CSB-YP850179MOV-100, CSB-YP850179MOV-20
• Hersteller: Cusabio
• Kategorie: Proteine/Peptide
• Alternative Synonym: T-cell receptor T3 gamma chain CD_antigen: CD3g,CSB-PR2024

Produkteigenschaften

• Molekulargewicht: 12.5 kDa
• Tag: N-terminal 6xHis-tagged
• UniProt: Q95LI7
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Yeast
• Expression System: 23-113aa
• Reinheit: Greater than 90% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: QSFEENRKLNVYNQEDGSVLLTCHVKNTNITWFKEGKMIDILTAHKNKWNLGSNTKDPRGVYQCKGSKDKSKTLQVYYRMCQNCIELNAAT