Recombinant Human Mixed lineage kinase domain-like protein (MLKL)

Produktübersicht

• Artikelname: Recombinant Human Mixed lineage kinase domain-like protein (MLKL)
• Artikelnummer: CSB-YP850851HU
• Hersteller Artikelnummer: CSB-YP850851HU
• Alternativnummer: CSB-YP850851HU-1, CSB-YP850851HU-100, CSB-YP850851HU-20
• Hersteller: Cusabio
• Kategorie: Proteine/Peptide
• Alternative Synonym: 9130019I15Rik, FLJ34389, hMLKL, Mixed lineage kinase domain like, Mixed lineage kinase domain like protein, Mixed lineage kinase domain like pseudokinase, Mixed lineage kinase domain-like protein, Mlkl, MLKL_HUMAN

Produkteigenschaften

• Molekulargewicht: 56.5 kDa
• Tag: N-terminal 6xHis-tagged
• UniProt: Q8NB16
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Yeast
• Expression System: 1-471aa
• Reinheit: Greater than 90% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: MENLKHIITLGQVIHKRCEEMKYCKKQCRRLGHRVLGLIKPLEMLQDQGKRSVPSEKLTTAMNRFKAALEEANGEIEKFSNRSNICRFLTASQDKILFKDVNRKLSDVWKELSLLLQVEQRMPVSPISQGASWAQEDQQDADEDRRAFQMLRRDNEKIEASLRRLEINMKEIKETLRQYLPPKCMQEIPQEQIKEIKKEQLSGSPWILLRENEVSTLYKGEYHRAPVAIKVFKKLQAGSIAIVRQTFNKEIKTM