Recombinant Mouse Alanine aminotransferase 1 (Gpt)

Artikelnummer: CSB-YP851235MO
Artikelname: Recombinant Mouse Alanine aminotransferase 1 (Gpt)
Artikelnummer: CSB-YP851235MO
Hersteller Artikelnummer: CSB-YP851235MO
Alternativnummer: CSB-YP851235MO-1, CSB-YP851235MO-100, CSB-YP851235MO-20
Hersteller: Cusabio
Kategorie: Proteine/Peptide
Alternative Synonym: ALT1 Alternative name(s): Glutamate pyruvate transaminase 1 Short name: GPT 1 Glutamic--alanine transaminase 1 Glutamic--pyruvic transaminase 1
Molekulargewicht: 57 kDa
Tag: N-terminal 6xHis-tagged
UniProt: Q8QZR5
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Yeast
Expression System: 2-496aa
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: ASQRNDRIQASRNGLKGKVLTLDTMNPCVRRVEYAVRGPIVQRALELEQELRQGVKKPFTEVIRANIGDAQAMGQRPITFFRQVLALCVYPNLLSSPDFPEDAKRRAERILQACGGHSLGAYSISSGIQPIREDVAQYIERRDGGIPADPNNIFLSTGASDAIVTMLKLLVAGEGRARTGVLIPIPQYPLYSAALAELDAVQVDYYLDEERAWALDIAELRRALCQARDRCCPRVLCVINPGNPTGQVQTRECI