Recombinant Human Store-opeRated calcium entry-associated regulatory factor (SARAF), partial

Produktübersicht

• Artikelname: Recombinant Human Store-opeRated calcium entry-associated regulatory factor (SARAF), partial
• Artikelnummer: CSB-YP853392HU
• Hersteller Artikelnummer: CSB-YP853392HU
• Alternativnummer: CSB-YP853392HU-1, CSB-YP853392HU-100, CSB-YP853392HU-20
• Hersteller: Cusabio
• Kategorie: Proteine/Peptide
• Alternative Synonym: HBV X-transactivated gene 3 protein HBV XAg-transactivated protein 3 Protein FOAP-7 Transmembrane protein 66

Produkteigenschaften

• Molekulargewicht: 17.5 kDa
• Tag: N-terminal 6xHis-tagged
• UniProt: Q96BY9
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Yeast
• Expression System: 195-339aa
• Reinheit: Greater than 90% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: SDGQYSPPPYSEYPPFSHRYQRFTNSAGPPPPGFKSEFTGPQNTGHGATSGFGSAFTGQQGYENSGPGFWTGLGTGGILGYLFGSNRAATPFSDSWYYPSYPPSYPGTWNRAYSPLHGGSGSYSVCSNSDTKTRTASGYGGTRRR