Recombinant Crotalus atrox Snake venom serine protease catroxase-2

Produktübersicht

• Artikelname: Recombinant Crotalus atrox Snake venom serine protease catroxase-2
• Artikelnummer: CSB-YP854470DYC
• Hersteller Artikelnummer: CSB-YP854470DYC
• Alternativnummer: CSB-YP854470DYC-1, CSB-YP854470DYC-100, CSB-YP854470DYC-20
• Hersteller: Cusabio
• Kategorie: Proteine/Peptide
• Alternative Synonym: Catroxase II Kallikrein-like EI,CSB-PR2024

Produkteigenschaften

• Molekulargewicht: 27.2 kDa
• Tag: N-terminal 6xHis-tagged
• UniProt: Q8QHK2
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Yeast
• Expression System: 25-258aa
• Reinheit: Greater than 85% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: VVGGDECNINEHRSLVAIFNSTEFFCSGTLINQEWVVTAAHCDSTNFKMKLGVHSKKVPNEDEQTRNPKEKFFCPNKKKDDVLDKDIMLIKLDSPVSNSEHIAPLSLPSSPPSVGSVCHIMGWGSITPIEKTLPDVPYCANIKLLDDAVCQPPYPELPATSRTLCAGIPEGGKDTCGGDSGGPLICNGQFQGIVFYGAHPCGQALKPGVYTKVFDYNDWIQSIIAGNTAATCPP