Recombinant Dog C-C motif chemokine 17 (CCL17)
Artikelnummer:
CSB-YP856825DO
- Bilder (0)
| Artikelname: | Recombinant Dog C-C motif chemokine 17 (CCL17) |
| Artikelnummer: | CSB-YP856825DO |
| Hersteller Artikelnummer: | CSB-YP856825DO |
| Alternativnummer: | CSB-YP856825DO-1, CSB-YP856825DO-100, CSB-YP856825DO-20 |
| Hersteller: | Cusabio |
| Kategorie: | Proteine/Peptide |
| Alternative Synonym: | (CC chemokine TARC)(Small-inducible cytokine A17)(Thymus and activation-regulated chemokine),CSB-PR2024 |
| Molekulargewicht: | 10.1 kDa |
| Tag: | C-terminal 6xHis-tagged |
| UniProt: | Q95N01 |
| Puffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Quelle: | Yeast |
| Expression System: | 24-99aa |
| Reinheit: | Greater than 85% as determined by SDS-PAGE. |
| Formulierung: | Liquid or Lyophilized powder |
| Sequenz: | ARGTNVGRECCLEYFKGAIPISRLTRWYKTSGECPKDAIVFVTVQGKSICSDPKDKRVKKAVRYLQRTWKGGPQES |
Produktgarantie und fachkundiger Support
