Recombinant Staphylococcus aureus Staphylococcal complement inhibitor (scn)
Artikelnummer:
CSB-YP858805SKY
- Bilder (0)
| Artikelname: | Recombinant Staphylococcus aureus Staphylococcal complement inhibitor (scn) |
| Artikelnummer: | CSB-YP858805SKY |
| Hersteller Artikelnummer: | CSB-YP858805SKY |
| Alternativnummer: | CSB-YP858805SKY-1, CSB-YP858805SKY-100, CSB-YP858805SKY-20 |
| Hersteller: | Cusabio |
| Kategorie: | Proteine/Peptide |
| Alternative Synonym: | scn, SA1754, Staphylococcal complement inhibitor, SCIN |
| Molekulargewicht: | 12.3 kDa |
| Tag: | N-terminal 10xHis-tagged |
| UniProt: | Q99SU9 |
| Puffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Quelle: | Yeast |
| Expression System: | 32-116aa |
| Reinheit: | Greater than 85% as determined by SDS-PAGE. |
| Formulierung: | Liquid or Lyophilized powder |
| Sequenz: | STSLPTSNEYQNEKLANELKSLLDELNVNELATGSLNTYYKRTIKISGLKAMYALKSKDFKKMSEAKYQLQKIYNEIDEALKSKY |
Produktgarantie und fachkundiger Support
