Recombinant Staphylococcus aureus Staphopain B (sspB)

Artikelnummer: CSB-YP859203SKX
Artikelname: Recombinant Staphylococcus aureus Staphopain B (sspB)
Artikelnummer: CSB-YP859203SKX
Hersteller Artikelnummer: CSB-YP859203SKX
Alternativnummer: CSB-YP859203SKX-1, CSB-YP859203SKX-100, CSB-YP859203SKX-20
Hersteller: Cusabio
Kategorie: Proteine/Peptide
Alternative Synonym: Staphylococcal cysteine proteinase B Staphylopain B
Molekulargewicht: 21.9 kDa
Tag: N-terminal 6xHis-tagged
UniProt: Q99V46
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Yeast
Expression System: 220-393aa
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: DQVQYENTLKNFKIREQQFDNSWCAGFSMAALLNATKNTDTYNAHDIMRTLYPEVSEQDLPNCSTFPNQMIEYGKSQGRDIHYQEGVPSYEQVDQLTKDNVGIMILAQSVSQNPNDPHLGHALAVVGNAKINDQEKLIYWNPWDTELSIQDADSSLLHLSFNRDYNWYGSMIGY