Recombinant Mouse Nogo-B receptor (Nus1), partial
Artikelnummer:
CSB-YP860384MO
- Bilder (0)
| Artikelname: | Recombinant Mouse Nogo-B receptor (Nus1), partial |
| Artikelnummer: | CSB-YP860384MO |
| Hersteller Artikelnummer: | CSB-YP860384MO |
| Alternativnummer: | CSB-YP860384MO-1, CSB-YP860384MO-100, CSB-YP860384MO-20 |
| Hersteller: | Cusabio |
| Kategorie: | Proteine/Peptide |
| Alternative Synonym: | Di-trans,poly-cis-decaprenylcistransferaseCurated Nogo-B receptorBy similarity Short name: NgBRBy similarity Nuclear undecaprenyl pyrophosphate synthase 1 homolog |
| Molekulargewicht: | 13 kDa |
| Tag: | N-terminal 6xHis-tagged |
| UniProt: | Q99LJ8 |
| Puffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Quelle: | Yeast |
| Expression System: | 24-120aa |
| Reinheit: | Greater than 90% as determined by SDS-PAGE. |
| Formulierung: | Liquid or Lyophilized powder |
| Sequenz: | SWLRVRFGTWNWIWRRCCRAASAAVLAPLGFTLRKPRAVGRNRRHHRHPHGGPGPGPGPAATHPRLRWRADVRSLQKLPVHMGLLVTEEVQEPSFSD |
Produktgarantie und fachkundiger Support
