Recombinant Human Secreted Ly-6/uPAR domain-containing protein 2 (SLURP2)
Artikelnummer:
CSB-YP861187HU2
- Bilder (0)
| Artikelname: | Recombinant Human Secreted Ly-6/uPAR domain-containing protein 2 (SLURP2) |
| Artikelnummer: | CSB-YP861187HU2 |
| Hersteller Artikelnummer: | CSB-YP861187HU2 |
| Alternativnummer: | CSB-YP861187HU2-1, CSB-YP861187HU2-100, CSB-YP861187HU2-20 |
| Hersteller: | Cusabio |
| Kategorie: | Proteine/Peptide |
| Alternative Synonym: | Secreted LY6/PLAUR domain-containing protein 2 Secreted Ly-6/uPAR-related protein 2 |
| Molekulargewicht: | 10 kDa |
| Tag: | N-terminal 6xHis-tagged |
| UniProt: | P0DP57 |
| Puffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Quelle: | Yeast |
| Expression System: | 23-97aa |
| Reinheit: | Greater than 90% as determined by SDS-PAGE. |
| Formulierung: | Liquid or Lyophilized powder |
| Sequenz: | IWCHQCTGFGGCSHGSRCLRDSTHCVTTATRVLSNTEDLPLVTKMCHIGCPDIPSLGLGPYVSIACCQTSLCNHD |
Produktgarantie und fachkundiger Support
