Recombinant Mouse Mixed lineage kinase domain-like protein (Mlkl)

Produktübersicht

• Artikelname: Recombinant Mouse Mixed lineage kinase domain-like protein (Mlkl)
• Artikelnummer: CSB-YP861529MO
• Hersteller Artikelnummer: CSB-YP861529MO
• Alternativnummer: CSB-YP861529MO-1, CSB-YP861529MO-100, CSB-YP861529MO-20
• Hersteller: Cusabio
• Kategorie: Proteine/Peptide
• Alternative Synonym: MlklMixed lineage kinase domain-like protein

Produkteigenschaften

• Molekulargewicht: 56.3 kDa
• Tag: N-terminal 6xHis-tagged
• UniProt: Q9D2Y4
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Yeast
• Expression System: 1-472aa
• Reinheit: Greater than 90% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: MDKLGQIIKLGQLIYEQCEKMKYCRKQCQRLGNRVHGLLQPLQRLQAQGKKNLPDDITAALGRFDEVLKEANQQIEKFSKKSHIWKFVSVGNDKILFHEVNEKLRDVWEELLLLLQVYHWNTVSDVSQPASWQQEDRQDAEEDGNENMKVILMQLQISVEEINKTLKQCSLKPTQEIPQDLQIKEIPKEHLGPPWTKLKTSKMSTIYRGEYHRSPVTIKVFNNPQAESVGIVRFTFNDEIKTMKKFDSPNILRI