Recombinant Mouse Protein FAM3B (Fam3b)

Artikelnummer: CSB-YP861530MO
Artikelname: Recombinant Mouse Protein FAM3B (Fam3b)
Artikelnummer: CSB-YP861530MO
Hersteller Artikelnummer: CSB-YP861530MO
Alternativnummer: CSB-YP861530MO-1, CSB-YP861530MO-100, CSB-YP861530MO-20
Hersteller: Cusabio
Kategorie: Proteine/Peptide
Alternative Synonym: (Cytokine-like protein 2-21)(Pancreatic-derived factor)(PANDER),CSB-PR2024
Molekulargewicht: 25.0 kDa
Tag: N-terminal 8xHis-tagged
UniProt: Q9D309
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Yeast
Expression System: 30-235aa
Reinheit: Greater than 85% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: ELIPDVPLSSTLYNIRSIGERPVLKAPAPKRQKCDHWSPCPPDTYAYRLLSGGGRDKYAKICFEDEVLIGEKTGNVARGINIAVVNYETGKVIATKYFDMYEGDNSGPMAKFIQSTPSKSLLFMVTHDDGSSKLKAQAKDAIEALGSKEIKNMKFRSSWVFVAAKGFELPSEIEREKINHSDQSRNRYAGWPAEIQIEGCIPKGLR