Recombinant Human Group XIIA secretory phospholipase A2 (PLA2G12A), partial
Artikelnummer:
CSB-YP863638HU
- Bilder (0)
| Artikelname: | Recombinant Human Group XIIA secretory phospholipase A2 (PLA2G12A), partial |
| Artikelnummer: | CSB-YP863638HU |
| Hersteller Artikelnummer: | CSB-YP863638HU |
| Alternativnummer: | CSB-YP863638HU-1, CSB-YP863638HU-100, CSB-YP863638HU-20 |
| Hersteller: | Cusabio |
| Kategorie: | Proteine/Peptide |
| Alternative Synonym: | Phosphatidylcholine 2-acylhydrolase 12A |
| Molekulargewicht: | 20.3 kDa |
| Tag: | N-terminal 6xHis-tagged |
| UniProt: | Q9BZM1 |
| Puffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Quelle: | Yeast |
| Expression System: | 23-185aa |
| Reinheit: | Greater than 90% as determined by SDS-PAGE. |
| Formulierung: | Liquid or Lyophilized powder |
| Sequenz: | QEQAQTTDWRATLKTIRNGVHKIDTYLNAALDLLGGEDGLCQYKCSDGSKPFPRYGYKPSPPNGCGSPLFGVHLNIGIPSLTKCCNQHDRCYETCGKSKNDCDEEFQYCLSKICRDVQKTLGLTQHVQACETTVELLFDSVIHLGCKPYLDSQRAACRCHYEE |
Produktgarantie und fachkundiger Support
