Recombinant Mouse BAG family molecular chaperone regulator 3 (Bag3)

Produktübersicht

• Artikelname: Recombinant Mouse BAG family molecular chaperone regulator 3 (Bag3)
• Artikelnummer: CSB-YP864372MO
• Hersteller Artikelnummer: CSB-YP864372MO
• Alternativnummer: CSB-YP864372MO-1, CSB-YP864372MO-100, CSB-YP864372MO-20
• Hersteller: Cusabio
• Kategorie: Proteine/Peptide
• Alternative Synonym: Bcl-2-associated athanogene 3Bcl-2-binding protein Bis

Produkteigenschaften

• Molekulargewicht: 63.7 kDa
• Tag: N-terminal 6xHis-tagged
• UniProt: Q9JLV1
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Yeast
• Expression System: 2-577aa
• Reinheit: Greater than 90% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: SAATQSPMMQMASGNGASDRDPLPPGWEIKIDPQTGWPFFVDHNSRTTTWNDPRVPPEGPKDTASSANGPSRDGSRLLPIREGHPIYPQLRPGYIPIPVLHEGSENRQPHLFHAYSQPGVQRFRTEAAAATPQRSQSPLRGGMTEAAQTDKQCGQMPATATTAAAQPPTAHGPERSQSPAASDCSSSSSSASLPSSGRSSLGSHQLPRGYIPIPVIHEQNITRPAAQPSFHQAQKTHYPAQQGEYQPQQPVYHK