Recombinant Mouse Sialidase-2 (Neu2)
Artikelnummer:
CSB-YP864379MOB0
- Bilder (0)
| Artikelname: | Recombinant Mouse Sialidase-2 (Neu2) |
| Artikelnummer: | CSB-YP864379MOB0 |
| Hersteller Artikelnummer: | CSB-YP864379MOb0 |
| Alternativnummer: | CSB-YP864379MOB0-1, CSB-YP864379MOB0-100, CSB-YP864379MOB0-20 |
| Hersteller: | Cusabio |
| Kategorie: | Proteine/Peptide |
| Alternative Synonym: | Cytosolic sialidase (Mouse skeletal muscle sialidase) (MSS) (Murine thymic sialidase) (MTS) (N-acetyl-alpha-neuraminidase 2) |
| Molekulargewicht: | 44.9 kDa |
| Tag: | N-terminal 10xHis-tagged |
| UniProt: | Q9JMH3 |
| Puffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Quelle: | Yeast |
| Expression System: | 1-379aa |
| Reinheit: | Greater than 85% as determined by SDS-PAGE. |
| Formulierung: | Liquid or Lyophilized powder |
| Sequenz: | MATCPVLQKETLFRTGVHAYRIPALLYLKKQKTLLAFAEKRASKTDEHAELIVLRRGSYNEATNRVKWQPEEVVTQAQLEGHRSMNPCPLYDKQTKTLFLFFIAVPGRVSEHHQLHTKVNVTRLCCVSSTDHGRTWSPIQDLTETTIGSTHQEWATFAVGPGHCLQLRNPAGSLLVPAYAYRKLHPAQKPTPFAFCFISLDHGHTWKLGNFVAENSLECQVAEVGTGAQRMVYLNARSFLGARVQAQSPNDGLD |
Produktgarantie und fachkundiger Support
