Recombinant Hepatitis B virus genotype D subtype ayw Protein X (X)

Produktübersicht

• Artikelname: Recombinant Hepatitis B virus genotype D subtype ayw Protein X (X)
• Artikelnummer: CSB-YP865559HEO
• Hersteller Artikelnummer: CSB-YP865559HEO
• Alternativnummer: CSB-YP865559HEO-1, CSB-YP865559HEO-100, CSB-YP865559HEO-20
• Hersteller: Cusabio
• Kategorie: Proteine/Peptide
• Alternative Synonym: HBx (Peptide X) (pX),CSB-PR2024

Produkteigenschaften

• Molekulargewicht: 18.1 kDa
• Tag: N-terminal 6xHis-tagged
• UniProt: Q9QMI3
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Yeast
• Expression System: 1-154aa
• Reinheit: Greater than 85% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGSLSSSSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQILPKILHKRTLGLSTMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA