Recombinant Human Stimulated by retinoic acid gene 6 protein homolog (STRA6), partial
Artikelnummer:
CSB-YP866301HU1
- Bilder (0)
| Artikelname: | Recombinant Human Stimulated by retinoic acid gene 6 protein homolog (STRA6), partial |
| Artikelnummer: | CSB-YP866301HU1 |
| Hersteller Artikelnummer: | CSB-YP866301HU1 |
| Alternativnummer: | CSB-YP866301HU1-1, CSB-YP866301HU1-100, CSB-YP866301HU1-20 |
| Hersteller: | Cusabio |
| Kategorie: | Proteine/Peptide |
| Alternative Synonym: | (Retinol-binding protein receptor STRA6)(Stimulated by retinoic acid gene 6 protein homolog),CSB-PR2024 |
| Molekulargewicht: | 33.4 kDa |
| Tag: | C-terminal hFc-tagged |
| UniProt: | Q9BX79 |
| Puffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Quelle: | Yeast |
| Expression System: | 1-50aa |
| Reinheit: | Greater than 90% as determined by SDS-PAGE. |
| Formulierung: | Liquid or Lyophilized powder |
| Sequenz: | MSSQPAGNQTSPGATEDYSYGSWYIDEPQGGEELQPEGEVPSCHTSIPPG |
Produktgarantie und fachkundiger Support
