Recombinant Human Phospholysine phosphohistidine inorganic pyrophosphate phosphatase (LHPP)
Artikelnummer:
CSB-YP867114HU
- Bilder (0)
| Artikelname: | Recombinant Human Phospholysine phosphohistidine inorganic pyrophosphate phosphatase (LHPP) |
| Artikelnummer: | CSB-YP867114HU |
| Hersteller Artikelnummer: | CSB-YP867114HU |
| Alternativnummer: | CSB-YP867114HU-1, CSB-YP867114HU-100, CSB-YP867114HU-20 |
| Hersteller: | Cusabio |
| Kategorie: | Proteine/Peptide |
| Alternative Synonym: | FLJ44846, FLJ46044, HDHD2B, hLHPP, lhpp, LHPP_HUMAN, Phospholysine phosphohistidine inorganic pyrophosphate phosphatase |
| Molekulargewicht: | 31.2 kDa |
| Tag: | N-terminal 6xHis-tagged |
| UniProt: | Q9H008 |
| Puffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Quelle: | Yeast |
| Expression System: | 1-270aa |
| Reinheit: | Greater than 90% as determined by SDS-PAGE. |
| Formulierung: | Liquid or Lyophilized powder |
| Sequenz: | MAPWGKRLAGVRGVLLDISGVLYDSGAGGGTAIAGSVEAVARLKRSRLKVRFCTNESQKSRAELVGQLQRLGFDISEQEVTAPAPAACQILKEQGLRPYLLIHDGVRSEFDQIDTSNPNCVVIADAGESFSYQNMNNAFQVLMELEKPVLISLGKGRYYKETSGLMLDVGPYMKALEYACGIKAEVVGKPSPEFFKSALQAIGVEAHQAVMIGDDIVGDVGGAQRCGMRALQVRTGKFRPSDEHHPEVKADGYV |
Produktgarantie und fachkundiger Support
