Recombinant Pinctada fucata N16.1 matrix protein

Produktübersicht

• Artikelname: Recombinant Pinctada fucata N16.1 matrix protein
• Artikelnummer: CSB-YP871337EVV
• Hersteller Artikelnummer: CSB-YP871337EVV
• Alternativnummer: CSB-YP871337EVV-1, CSB-YP871337EVV-100, CSB-YP871337EVV-20
• Hersteller: Cusabio
• Kategorie: Proteine/Peptide
• Alternative Synonym: N16.1 matrix protein, N141

Produkteigenschaften

• Molekulargewicht: 14.9 kDa
• Tag: N-terminal 6xHis-tagged
• UniProt: Q9TVT2
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Yeast
• Expression System: 24-131aa
• Reinheit: Greater than 90% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: AYHKKCGRYSYCWIPYDIERDRRDNGGKKYCFCRYAWSPWQCNEEERYEWLRCGMRFYSLCCYTDDDNGNGNGNGNGNGLNYLKSLYGGYGNGNGEFREEYIDERYDN