Recombinant Human E3 ubiquitin-protein ligase SMURF2 (SMURF2)

Produktübersicht

• Artikelname: Recombinant Human E3 ubiquitin-protein ligase SMURF2 (SMURF2)
• Artikelnummer: CSB-YP872532HU
• Hersteller Artikelnummer: CSB-YP872532HU
• Alternativnummer: CSB-YP872532HU-1, CSB-YP872532HU-100, CSB-YP872532HU-20
• Hersteller: Cusabio
• Kategorie: Proteine/Peptide
• Alternative Synonym: SMAD ubiquitination regulatory factor 2SMAD-specific E3 ubiquitin-protein ligase 2

Produkteigenschaften

• Molekulargewicht: 88.2 kDa
• Tag: N-terminal 6xHis-tagged
• UniProt: Q9HAU4
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Yeast
• Expression System: 1-748aa
• Reinheit: Greater than 90% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: MSNPGGRRNGPVKLRLTVLCAKNLVKKDFFRLPDPFAKVVVDGSGQCHSTDTVKNTLDPKWNQHYDLYIGKSDSVTISVWNHKKIHKKQGAGFLGCVRLLSNAINRLKDTGYQRLDLCKLGPNDNDTVRGQIVVSLQSRDRIGTGGQVVDCSRLFDNDLPDGWEERRTASGRIQYLNHITRTTQWERPTRPASEYSSPGRPLSCFVDENTPISGTNGATCGQSSDPRLAERRVRSQRHRNYMSRTHLHTPPDLP