Recombinant Mouse 14-3-3 protein beta/alpha (Ywhab)

Produktübersicht

• Artikelname: Recombinant Mouse 14-3-3 protein beta/alpha (Ywhab)
• Artikelnummer: CSB-YP875120MOB0
• Hersteller Artikelnummer: CSB-YP875120MOb0
• Alternativnummer: CSB-YP875120MOB0-1, CSB-YP875120MOB0-100, CSB-YP875120MOB0-20
• Hersteller: Cusabio
• Kategorie: Proteine/Peptide
• Alternative Synonym: Protein kinase C inhibitor protein 1

Produkteigenschaften

• Molekulargewicht: 30.6 kDa
• Tag: N-terminal 10xHis-tagged
• UniProt: Q9CQV8
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Yeast
• Expression System: 1-246aa
• Reinheit: Greater than 85% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: MTMDKSELVQKAKLAEQAERYDDMAAAMKAVTEQGHELSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTERNEKKQQMGKEYREKIEAELQDICNDVLELLDKYLILNATQAESKVFYLKMKGDYFRYLSEVASGENKQTTVSNSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLNEESYKDSTLIMQLLRDNLTLWTSENQGDEGDAGEGEN