Recombinant Arabidopsis thaliana Beta-amylase 1, chloroplastic (BAM1),partial

Produktübersicht

• Artikelname: Recombinant Arabidopsis thaliana Beta-amylase 1, chloroplastic (BAM1),partial
• Artikelnummer: CSB-YP878501DOA
• Hersteller Artikelnummer: CSB-YP878501DOA
• Alternativnummer: CSB-YP878501DOA-1, CSB-YP878501DOA-100, CSB-YP878501DOA-20
• Hersteller: Cusabio
• Kategorie: Proteine/Peptide
• Alternative Synonym: 1,4-alpha-D-glucan maltohydrolase () () () () () () () Beta-amylase 7 Thioredoxin-regulated beta-amylase Short name: TR-BAMY BMY7, TRBAMY

Produkteigenschaften

• Molekulargewicht: 36.3 kDa
• Tag: N-terminal 6xHis-tagged
• UniProt: Q9LIR6
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Yeast
• Expression System: 42-354aa
• Reinheit: Greater than 85% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: AMNRNYKAHGTDPSPPMSPILGATRADLSVACKAFAVENGIGTIEEQRTYREGGIGGKKEGGGGVPVFVMMPLDSVTMGNTVNRRKAMKASLQALKSAGVEGIMIDVWWGLVEKESPGTYNWGGYNELLELAKKLGLKVQAVMSFHQCGGNVGDSVTIPLPQWVVEEVDKDPDLAYTDQWGRRNHEYISLGADTLPVLKGRTPVQCYADFMRAFRDNFKHLLGETIVEIQVGMGPAGELRYPSYPEQEGTWKFP