Recombinant Bovine coronavirus Spike glycoprotein (S), partial

Produktübersicht

• Artikelname: Recombinant Bovine coronavirus Spike glycoprotein (S), partial
• Artikelnummer: CSB-YP879403BJL
• Hersteller Artikelnummer: CSB-YP879403BJL
• Alternativnummer: CSB-YP879403BJL-1, CSB-YP879403BJL-100, CSB-YP879403BJL-20
• Hersteller: Cusabio
• Kategorie: Proteine/Peptide
• Alternative Synonym: S glycoprotein,E2,Peplomer protein,CSB-PR2024

Produkteigenschaften

• Molekulargewicht: 36.5 kDa
• Tag: C-terminal 6xHis-tagged
• UniProt: Q9QAQ8
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Yeast
• Expression System: 314-634aa
• Reinheit: Greater than 90% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: TVQPIADVYRRIPNLPDCNIEAWLNDKSVPSPLNWERKTFSNCNFNMSSLMSFIQADSFTCNNIDAAKIYGMCFSSITIDKFAIPNGRKVDLQLGNLGYLQSFNYRIDTTATSCQLYYNLPAANVSVSRFNPSIWNRRFGFTEQSVFKPQPAGVFTDHDVVYAQHCFKAPTNFCPCKLDGSLCVGSGSGIDAGYKNTGIGTCPAGTNYLTCHNAAQCGCLCTPDPITSKATGPYKCPQTKYLVGIGEHCSGLAI